PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G084500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family bHLH
Protein Properties Length: 75aa    MW: 8268.31 Da    PI: 5.8451
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G084500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH26.89e-0914541454
                       HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                       d+iN+   +++el+Pk s ++s + s + iL++A++Y+ksL
  Aqcoe3G084500.1.p 14 DEINDFVGKIQELIPKTSFGSSARASTSNILKEACKYMKSL 54
                       689*************6679*******************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474593.53E-81468IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000103.4E-61454IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.107.8E-91468IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 75 aa     Download sequence    Send to blast
MSSRRSRSSE ITGDEINDFV GKIQELIPKT SFGSSARAST SNILKEACKY MKSLHREVDD  60
LSEKLTEMLA SLDQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001148242.17e-22uncharacterized protein LOC100281850
RefseqXP_010939530.16e-22PREDICTED: transcription factor ILI5-like
TrEMBLB6SZJ48e-22B6SZJ4_MAIZE; DNA binding protein
STRINGGSMUA_Achr9P09010_0012e-20(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.15e-19bHLH family protein